IGFBP6 monoclonal antibody (M02), clone 1A8
  • IGFBP6 monoclonal antibody (M02), clone 1A8

IGFBP6 monoclonal antibody (M02), clone 1A8

Ref: AB-H00003489-M02
IGFBP6 monoclonal antibody (M02), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IGFBP6.
Información adicional
Size 100 ug
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGFBP6 (AAH03507.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3489
Clone Number 1A8
Iso type IgG2a

Enviar un mensaje


IGFBP6 monoclonal antibody (M02), clone 1A8

IGFBP6 monoclonal antibody (M02), clone 1A8