IGFBP6 polyclonal antibody (A01)
  • IGFBP6 polyclonal antibody (A01)

IGFBP6 polyclonal antibody (A01)

Ref: AB-H00003489-A01
IGFBP6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IGFBP6.
Información adicional
Size 50 uL
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGFBP6 (AAH03507, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3489

Enviar un mensaje


IGFBP6 polyclonal antibody (A01)

IGFBP6 polyclonal antibody (A01)