IGFBP3 monoclonal antibody (M02), clone 2G6
  • IGFBP3 monoclonal antibody (M02), clone 2G6

IGFBP3 monoclonal antibody (M02), clone 2G6

Ref: AB-H00003486-M02
IGFBP3 monoclonal antibody (M02), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IGFBP3.
Información adicional
Size 100 ug
Gene Name IGFBP3
Gene Alias BP-53|IBP3
Gene Description insulin-like growth factor binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGFBP3 (NP_000589.1, 182 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3486
Clone Number 2G6
Iso type IgG2a Kappa

Enviar un mensaje


IGFBP3 monoclonal antibody (M02), clone 2G6

IGFBP3 monoclonal antibody (M02), clone 2G6