IGFBP1 monoclonal antibody (M01), clone 2F9
  • IGFBP1 monoclonal antibody (M01), clone 2F9

IGFBP1 monoclonal antibody (M01), clone 2F9

Ref: AB-H00003484-M01
IGFBP1 monoclonal antibody (M01), clone 2F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IGFBP1.
Información adicional
Size 100 ug
Gene Name IGFBP1
Gene Alias AFBP|IBP1|IGF-BP25|PP12|hIGFBP-1
Gene Description insulin-like growth factor binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGFBP1 (NP_000587, 160 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3484
Clone Number 2F9
Iso type IgG2a Kappa

Enviar un mensaje


IGFBP1 monoclonal antibody (M01), clone 2F9

IGFBP1 monoclonal antibody (M01), clone 2F9