IGFBP1 polyclonal antibody (A01)
  • IGFBP1 polyclonal antibody (A01)

IGFBP1 polyclonal antibody (A01)

Ref: AB-H00003484-A01
IGFBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IGFBP1.
Información adicional
Size 50 uL
Gene Name IGFBP1
Gene Alias AFBP|IBP1|IGF-BP25|PP12|hIGFBP-1
Gene Description insulin-like growth factor binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGFBP1 (NP_000587, 160 a.a. ~ 259 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3484

Enviar un mensaje


IGFBP1 polyclonal antibody (A01)

IGFBP1 polyclonal antibody (A01)