IGF2R polyclonal antibody (A01)
  • IGF2R polyclonal antibody (A01)

IGF2R polyclonal antibody (A01)

Ref: AB-H00003482-A01
IGF2R polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IGF2R.
Información adicional
Size 50 uL
Gene Name IGF2R
Gene Alias CD222|CIMPR|M6P-R|MPR1|MPRI
Gene Description insulin-like growth factor 2 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGF2R (NP_000867, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3482

Enviar un mensaje


IGF2R polyclonal antibody (A01)

IGF2R polyclonal antibody (A01)