IGF1R purified MaxPab rabbit polyclonal antibody (D01P)
  • IGF1R purified MaxPab rabbit polyclonal antibody (D01P)

IGF1R purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003480-D01P
IGF1R purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IGF1R protein.
Información adicional
Size 100 ug
Gene Name IGF1R
Gene Alias CD221|IGFIR|JTK13|MGC142170|MGC142172|MGC18216
Gene Description insulin-like growth factor 1 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IGF1R (NP_000866.1, 1 a.a. ~ 1367 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3480

Enviar un mensaje


IGF1R purified MaxPab rabbit polyclonal antibody (D01P)

IGF1R purified MaxPab rabbit polyclonal antibody (D01P)