IGF1R polyclonal antibody (A01)
  • IGF1R polyclonal antibody (A01)

IGF1R polyclonal antibody (A01)

Ref: AB-H00003480-A01
IGF1R polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IGF1R.
Información adicional
Size 50 uL
Gene Name IGF1R
Gene Alias CD221|IGFIR|JTK13|MGC142170|MGC142172|MGC18216
Gene Description insulin-like growth factor 1 receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGF1R (NP_000866, 761 a.a. ~ 870 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3480

Enviar un mensaje


IGF1R polyclonal antibody (A01)

IGF1R polyclonal antibody (A01)