IGF1 polyclonal antibody (A01)
  • IGF1 polyclonal antibody (A01)

IGF1 polyclonal antibody (A01)

Ref: AB-H00003479-A01
IGF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IGF1.
Información adicional
Size 50 uL
Gene Name IGF1
Gene Alias IGFI
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSRDLRRLEMYCAPLKPTKSARSVRAQRHTDMPKTQKEVHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IGF1 (NP_000609, 49 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3479

Enviar un mensaje


IGF1 polyclonal antibody (A01)

IGF1 polyclonal antibody (A01)