IFNW1 polyclonal antibody (A01)
  • IFNW1 polyclonal antibody (A01)

IFNW1 polyclonal antibody (A01)

Ref: AB-H00003467-A01
IFNW1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFNW1.
Información adicional
Size 50 uL
Gene Name IFNW1
Gene Alias -
Gene Description interferon, omega 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNW1 (NP_002168, 22 a.a. ~ 104 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3467

Enviar un mensaje


IFNW1 polyclonal antibody (A01)

IFNW1 polyclonal antibody (A01)