IFNGR1 MaxPab rabbit polyclonal antibody (D01)
  • IFNGR1 MaxPab rabbit polyclonal antibody (D01)

IFNGR1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003459-D01
IFNGR1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFNGR1 protein.
Información adicional
Size 100 uL
Gene Name IFNGR1
Gene Alias CD119|FLJ45734|IFNGR
Gene Description interferon gamma receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNGR1 (AAH05333.1, 1 a.a. ~ 489 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3459

Enviar un mensaje


IFNGR1 MaxPab rabbit polyclonal antibody (D01)

IFNGR1 MaxPab rabbit polyclonal antibody (D01)