IFNG purified MaxPab mouse polyclonal antibody (B02P)
  • IFNG purified MaxPab mouse polyclonal antibody (B02P)

IFNG purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00003458-B02P
IFNG purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IFNG protein.
Información adicional
Size 50 ug
Gene Name IFNG
Gene Alias IFG|IFI
Gene Description interferon, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNG (NP_000610, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3458

Enviar un mensaje


IFNG purified MaxPab mouse polyclonal antibody (B02P)

IFNG purified MaxPab mouse polyclonal antibody (B02P)