IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)

IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003452-D01P
IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFNA21 protein.
Información adicional
Size 100 ug
Gene Name IFNA21
Gene Alias MGC126687|MGC126689
Gene Description interferon, alpha 21
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNA21 (AAH69329.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3452

Enviar un mensaje


IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)

IFNA21 purified MaxPab rabbit polyclonal antibody (D01P)