IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)

IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003443-D01P
IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFNA6 protein.
Información adicional
Size 100 ug
Gene Name IFNA6
Gene Alias -
Gene Description interferon, alpha 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNA6 (NP_066282.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3443

Enviar un mensaje


IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)

IFNA6 purified MaxPab rabbit polyclonal antibody (D01P)