IFNA5 MaxPab rabbit polyclonal antibody (D01)
  • IFNA5 MaxPab rabbit polyclonal antibody (D01)

IFNA5 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003442-D01
IFNA5 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFNA5 protein.
Información adicional
Size 100 uL
Gene Name IFNA5
Gene Alias INFA5
Gene Description interferon, alpha 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNA5 (NP_002160.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3442

Enviar un mensaje


IFNA5 MaxPab rabbit polyclonal antibody (D01)

IFNA5 MaxPab rabbit polyclonal antibody (D01)