IFNA2 monoclonal antibody (M15), clone 2A6 Ver mas grande

IFNA2 monoclonal antibody (M15), clone 2A6

AB-H00003440-M15

Producto nuevo

IFNA2 monoclonal antibody (M15), clone 2A6

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name IFNA2
Gene Alias IFNA|INFA2|MGC125764|MGC125765
Gene Description interferon, alpha 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3440
Clone Number 2A6
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant IFNA2.

Consulta sobre un producto

IFNA2 monoclonal antibody (M15), clone 2A6

IFNA2 monoclonal antibody (M15), clone 2A6