Ver mas grande
IFNA2 monoclonal antibody (M10), clone 3A3
AB-H00003440-M10
Producto nuevo
IFNA2 monoclonal antibody (M10), clone 3A3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | IFNA2 |
| Gene Alias | IFNA|INFA2|MGC125764|MGC125765 |
| Gene Description | interferon, alpha 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | MDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IFNA2 (NP_000596, 24 a.a. ~ 188 a.a) partial recombinant protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3440 |
| Clone Number | 3A3 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant IFNA2.