IFNA1 monoclonal antibody (M07), clone 3C6
  • IFNA1 monoclonal antibody (M07), clone 3C6

IFNA1 monoclonal antibody (M07), clone 3C6

Ref: AB-H00003439-M07
IFNA1 monoclonal antibody (M07), clone 3C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IFNA1.
Información adicional
Size 100 ug
Gene Name IFNA1
Gene Alias IFL|IFN|IFN-ALPHA|IFNA13|IFNA@|MGC138207|MGC138505|MGC138507
Gene Description interferon, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFNA1 (NP_076918, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3439
Clone Number 3C6
Iso type IgG2b Kappa

Enviar un mensaje


IFNA1 monoclonal antibody (M07), clone 3C6

IFNA1 monoclonal antibody (M07), clone 3C6