IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)

IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003437-D01P
IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFIT3 protein.
Información adicional
Size 100 ug
Gene Name IFIT3
Gene Alias CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|RIG-G
Gene Description interferon-induced protein with tetratricopeptide repeats 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFIT3 (NP_001540.2, 1 a.a. ~ 490 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3437

Enviar un mensaje


IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)

IFIT3 purified MaxPab rabbit polyclonal antibody (D01P)