IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)

IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003434-D01P
IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFIT1 protein.
Información adicional
Size 100 ug
Gene Name IFIT1
Gene Alias G10P1|GARG-16|IFI-56|IFI56|IFNAI1|ISG56|RNM561
Gene Description interferon-induced protein with tetratricopeptide repeats 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFIT1 (NP_001001887.1, 1 a.a. ~ 478 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3434

Enviar un mensaje


IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)

IFIT1 purified MaxPab rabbit polyclonal antibody (D01P)