SP110 MaxPab rabbit polyclonal antibody (D01)
  • SP110 MaxPab rabbit polyclonal antibody (D01)

SP110 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003431-D01
SP110 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SP110 protein.
Información adicional
Size 100 uL
Gene Name SP110
Gene Alias FLJ22835|IFI41|IFI75|IPR1|VODI
Gene Description SP110 nuclear body protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYERQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SP110 (AAH19059.1, 1 a.a. ~ 547 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3431

Enviar un mensaje


SP110 MaxPab rabbit polyclonal antibody (D01)

SP110 MaxPab rabbit polyclonal antibody (D01)