SP110 polyclonal antibody (A01)
  • SP110 polyclonal antibody (A01)

SP110 polyclonal antibody (A01)

Ref: AB-H00003431-A01
SP110 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SP110.
Información adicional
Size 50 uL
Gene Name SP110
Gene Alias FLJ22835|IFI41|IFI75|IPR1|VODI
Gene Description SP110 nuclear body protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP110 (NP_004501, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3431

Enviar un mensaje


SP110 polyclonal antibody (A01)

SP110 polyclonal antibody (A01)