IFI35 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFI35 purified MaxPab rabbit polyclonal antibody (D01P)

IFI35 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003430-D01P
IFI35 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFI35 protein.
Información adicional
Size 100 ug
Gene Name IFI35
Gene Alias FLJ21753|IFP35
Gene Description interferon-induced protein 35
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFI35 (NP_005524.1, 1 a.a. ~ 288 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3430

Enviar un mensaje


IFI35 purified MaxPab rabbit polyclonal antibody (D01P)

IFI35 purified MaxPab rabbit polyclonal antibody (D01P)