IFI16 purified MaxPab rabbit polyclonal antibody (D01P)
  • IFI16 purified MaxPab rabbit polyclonal antibody (D01P)

IFI16 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003428-D01P
IFI16 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IFI16 protein.
Información adicional
Size 100 ug
Gene Name IFI16
Gene Alias IFNGIP1|MGC9466|PYHIN2
Gene Description interferon, gamma-inducible protein 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNTSSTENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFI16 (AAH17059.1, 1 a.a. ~ 729 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3428

Enviar un mensaje


IFI16 purified MaxPab rabbit polyclonal antibody (D01P)

IFI16 purified MaxPab rabbit polyclonal antibody (D01P)