IFI16 polyclonal antibody (A01)
  • IFI16 polyclonal antibody (A01)

IFI16 polyclonal antibody (A01)

Ref: AB-H00003428-A01
IFI16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IFI16.
Información adicional
Size 50 uL
Gene Name IFI16
Gene Alias IFNGIP1|MGC9466|PYHIN2
Gene Description interferon, gamma-inducible protein 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3428

Enviar un mensaje


IFI16 polyclonal antibody (A01)

IFI16 polyclonal antibody (A01)