IDS purified MaxPab rabbit polyclonal antibody (D01P)
  • IDS purified MaxPab rabbit polyclonal antibody (D01P)

IDS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003423-D01P
IDS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IDS protein.
Información adicional
Size 100 ug
Gene Name IDS
Gene Alias MPS2|SIDS
Gene Description iduronate 2-sulfatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPLENITLAPDPEV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDS (NP_000193.1, 1 a.a. ~ 550 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3423

Enviar un mensaje


IDS purified MaxPab rabbit polyclonal antibody (D01P)

IDS purified MaxPab rabbit polyclonal antibody (D01P)