IDS polyclonal antibody (A01)
  • IDS polyclonal antibody (A01)

IDS polyclonal antibody (A01)

Ref: AB-H00003423-A01
IDS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IDS.
Información adicional
Size 50 uL
Gene Name IDS
Gene Alias MPS2|SIDS
Gene Description iduronate 2-sulfatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IDS (NP_000193, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3423

Enviar un mensaje


IDS polyclonal antibody (A01)

IDS polyclonal antibody (A01)