IDI1 polyclonal antibody (A01)
  • IDI1 polyclonal antibody (A01)

IDI1 polyclonal antibody (A01)

Ref: AB-H00003422-A01
IDI1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IDI1.
Información adicional
Size 50 uL
Gene Name IDI1
Gene Alias IPP1|IPPI1
Gene Description isopentenyl-diphosphate delta isomerase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IDI1 (NP_004499, 175 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3422

Enviar un mensaje


IDI1 polyclonal antibody (A01)

IDI1 polyclonal antibody (A01)