Ver mas grande
IDH3G monoclonal antibody (M01A), clone S1
AB-H00003421-M01A
Producto nuevo
IDH3G monoclonal antibody (M01A), clone S1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | IDH3G |
| Gene Alias | H-IDHG |
| Gene Description | isocitrate dehydrogenase 3 (NAD+) gamma |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IDH3G (AAH00933, 1 a.a. ~ 393 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 3421 |
| Clone Number | S1 |
| Iso type | IgG1 Lambda |
Más información
Mouse monoclonal antibody raised against a full-length recombinant IDH3G.