IDH3B purified MaxPab rabbit polyclonal antibody (D01P)
  • IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003420-D01P
IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IDH3B protein.
Información adicional
Size 100 ug
Gene Name IDH3B
Gene Alias FLJ11043|H-IDHB|MGC903
Gene Description isocitrate dehydrogenase 3 (NAD+) beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDH3B (NP_008830.2, 1 a.a. ~ 385 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3420

Enviar un mensaje


IDH3B purified MaxPab rabbit polyclonal antibody (D01P)

IDH3B purified MaxPab rabbit polyclonal antibody (D01P)