ID4 purified MaxPab mouse polyclonal antibody (B01P)
  • ID4 purified MaxPab mouse polyclonal antibody (B01P)

ID4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003400-B01P
ID4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ID4 protein.
Información adicional
Size 50 ug
Gene Name ID4
Gene Alias IDB4|bHLHb27
Gene Description inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ID4 (NP_001537, 1 a.a. ~ 161 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3400

Enviar un mensaje


ID4 purified MaxPab mouse polyclonal antibody (B01P)

ID4 purified MaxPab mouse polyclonal antibody (B01P)