ID2 purified MaxPab rabbit polyclonal antibody (D03P)
  • ID2 purified MaxPab rabbit polyclonal antibody (D03P)

ID2 purified MaxPab rabbit polyclonal antibody (D03P)

Ref: AB-H00003398-D03P
ID2 purified MaxPab rabbit polyclonal antibody (D03P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ID2 protein.
Información adicional
Size 100 ug
Gene Name ID2
Gene Alias GIG8|ID2A|ID2H|MGC26389|bHLHb26
Gene Description inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3398

Enviar un mensaje


ID2 purified MaxPab rabbit polyclonal antibody (D03P)

ID2 purified MaxPab rabbit polyclonal antibody (D03P)