ID1 purified MaxPab mouse polyclonal antibody (B01P)
  • ID1 purified MaxPab mouse polyclonal antibody (B01P)

ID1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003397-B01P
ID1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ID1 protein.
Información adicional
Size 50 ug
Gene Name ID1
Gene Alias ID|bHLHb24
Gene Description inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ID1 (NP_002156.2, 1 a.a. ~ 155 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3397

Enviar un mensaje


ID1 purified MaxPab mouse polyclonal antibody (B01P)

ID1 purified MaxPab mouse polyclonal antibody (B01P)