ICT1 monoclonal antibody (M06), clone 4C10
  • ICT1 monoclonal antibody (M06), clone 4C10

ICT1 monoclonal antibody (M06), clone 4C10

Ref: AB-H00003396-M06
ICT1 monoclonal antibody (M06), clone 4C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ICT1.
Información adicional
Size 100 ug
Gene Name ICT1
Gene Alias DS-1
Gene Description immature colon carcinoma transcript 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICT1 (NP_001536, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3396
Clone Number 4C10
Iso type IgG2a Kappa

Enviar un mensaje


ICT1 monoclonal antibody (M06), clone 4C10

ICT1 monoclonal antibody (M06), clone 4C10