ICAM4 purified MaxPab mouse polyclonal antibody (B01P)
  • ICAM4 purified MaxPab mouse polyclonal antibody (B01P)

ICAM4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003386-B01P
ICAM4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ICAM4 protein.
Información adicional
Size 50 ug
Gene Name ICAM4
Gene Alias CD242|LW
Gene Description intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ICAM4 (NP_001034221.1, 1 a.a. ~ 272 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3386

Enviar un mensaje


ICAM4 purified MaxPab mouse polyclonal antibody (B01P)

ICAM4 purified MaxPab mouse polyclonal antibody (B01P)