ICA1 monoclonal antibody (M01), clone 6G11
  • ICA1 monoclonal antibody (M01), clone 6G11

ICA1 monoclonal antibody (M01), clone 6G11

Ref: AB-H00003382-M01
ICA1 monoclonal antibody (M01), clone 6G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ICA1.
Información adicional
Size 100 ug
Gene Name ICA1
Gene Alias ICA69|ICAp69
Gene Description islet cell autoantigen 1, 69kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICA1 (NP_071682, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3382
Clone Number 6G11
Iso type IgG2a Kappa

Enviar un mensaje


ICA1 monoclonal antibody (M01), clone 6G11

ICA1 monoclonal antibody (M01), clone 6G11