HYAL1 purified MaxPab mouse polyclonal antibody (B01P)
  • HYAL1 purified MaxPab mouse polyclonal antibody (B01P)

HYAL1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003373-B01P
HYAL1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HYAL1 protein.
Información adicional
Size 50 ug
Gene Name HYAL1
Gene Alias HYAL-1|LUCA1|MGC45987|NAT6
Gene Description hyaluronoglucosaminidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HYAL1 (NP_695015.1, 1 a.a. ~ 253 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3373

Enviar un mensaje


HYAL1 purified MaxPab mouse polyclonal antibody (B01P)

HYAL1 purified MaxPab mouse polyclonal antibody (B01P)