TNC polyclonal antibody (A01)
  • TNC polyclonal antibody (A01)

TNC polyclonal antibody (A01)

Ref: AB-H00003371-A01
TNC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNC.
Información adicional
Size 50 uL
Gene Name TNC
Gene Alias HXB|MGC167029|TN
Gene Description tenascin C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNC (NP_002151, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3371

Enviar un mensaje


TNC polyclonal antibody (A01)

TNC polyclonal antibody (A01)