HTR5A monoclonal antibody (M01), clone 10D3
  • HTR5A monoclonal antibody (M01), clone 10D3

HTR5A monoclonal antibody (M01), clone 10D3

Ref: AB-H00003361-M01
HTR5A monoclonal antibody (M01), clone 10D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR5A.
Información adicional
Size 100 ug
Gene Name HTR5A
Gene Alias 5-HT5A|MGC138226
Gene Description 5-hydroxytryptamine (serotonin) receptor 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR5A (NP_076917, 223 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3361
Clone Number 10D3
Iso type IgG1 Kappa

Enviar un mensaje


HTR5A monoclonal antibody (M01), clone 10D3

HTR5A monoclonal antibody (M01), clone 10D3