HTR2B monoclonal antibody (M01), clone 4A4
  • HTR2B monoclonal antibody (M01), clone 4A4

HTR2B monoclonal antibody (M01), clone 4A4

Ref: AB-H00003357-M01
HTR2B monoclonal antibody (M01), clone 4A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR2B.
Información adicional
Size 100 ug
Gene Name HTR2B
Gene Alias 5-HT(2B)|5-HT2B
Gene Description 5-hydroxytryptamine (serotonin) receptor 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3357
Clone Number 4A4
Iso type IgG2a Kappa

Enviar un mensaje


HTR2B monoclonal antibody (M01), clone 4A4

HTR2B monoclonal antibody (M01), clone 4A4