HTR2B polyclonal antibody (A01)
  • HTR2B polyclonal antibody (A01)

HTR2B polyclonal antibody (A01)

Ref: AB-H00003357-A01
HTR2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HTR2B.
Información adicional
Size 50 uL
Gene Name HTR2B
Gene Alias 5-HT(2B)|5-HT2B
Gene Description 5-hydroxytryptamine (serotonin) receptor 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3357

Enviar un mensaje


HTR2B polyclonal antibody (A01)

HTR2B polyclonal antibody (A01)