HTR1F polyclonal antibody (A01)
  • HTR1F polyclonal antibody (A01)

HTR1F polyclonal antibody (A01)

Ref: AB-H00003355-A01
HTR1F polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HTR1F.
Información adicional
Size 50 uL
Gene Name HTR1F
Gene Alias 5-HT1F|5HT6|HTR1EL|MR77
Gene Description 5-hydroxytryptamine (serotonin) receptor 1F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR1F (NP_000857, 203 a.a. ~ 279 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3355

Enviar un mensaje


HTR1F polyclonal antibody (A01)

HTR1F polyclonal antibody (A01)