HTR1E monoclonal antibody (M03), clone 2E9
  • HTR1E monoclonal antibody (M03), clone 2E9

HTR1E monoclonal antibody (M03), clone 2E9

Ref: AB-H00003354-M03
HTR1E monoclonal antibody (M03), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HTR1E.
Información adicional
Size 100 ug
Gene Name HTR1E
Gene Alias 5-HT1E
Gene Description 5-hydroxytryptamine (serotonin) receptor 1E
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR1E (NP_000856.1, 206 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3354
Clone Number 2E9
Iso type IgG2a Kappa

Enviar un mensaje


HTR1E monoclonal antibody (M03), clone 2E9

HTR1E monoclonal antibody (M03), clone 2E9