HTR1A polyclonal antibody (A01)
  • HTR1A polyclonal antibody (A01)

HTR1A polyclonal antibody (A01)

Ref: AB-H00003350-A01
HTR1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HTR1A.
Información adicional
Size 50 uL
Gene Name HTR1A
Gene Alias 5-HT1A|5HT1a|ADRB2RL1|ADRBRL1
Gene Description 5-hydroxytryptamine (serotonin) receptor 1A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTR1A (NP_000515, 1 a.a. ~ 36 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3350

Enviar un mensaje


HTR1A polyclonal antibody (A01)

HTR1A polyclonal antibody (A01)