HTN3 monoclonal antibody (M01), clone 4G9
  • HTN3 monoclonal antibody (M01), clone 4G9

HTN3 monoclonal antibody (M01), clone 4G9

Ref: AB-H00003347-M01
HTN3 monoclonal antibody (M01), clone 4G9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant HTN3.
Información adicional
Size 100 ug
Gene Name HTN3
Gene Alias HIS2|HTN2|HTN5
Gene Description histatin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3347
Clone Number 4G9
Iso type IgG2b Kappa

Enviar un mensaje


HTN3 monoclonal antibody (M01), clone 4G9

HTN3 monoclonal antibody (M01), clone 4G9