NDST1 polyclonal antibody (A01)
  • NDST1 polyclonal antibody (A01)

NDST1 polyclonal antibody (A01)

Ref: AB-H00003340-A01
NDST1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDST1.
Información adicional
Size 50 uL
Gene Name NDST1
Gene Alias HSST|NST1
Gene Description N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3340

Enviar un mensaje


NDST1 polyclonal antibody (A01)

NDST1 polyclonal antibody (A01)