HSPE1 monoclonal antibody (M01), clone 4C11-B11
  • HSPE1 monoclonal antibody (M01), clone 4C11-B11

HSPE1 monoclonal antibody (M01), clone 4C11-B11

Ref: AB-H00003336-M01
HSPE1 monoclonal antibody (M01), clone 4C11-B11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HSPE1.
Información adicional
Size 100 ug
Gene Name HSPE1
Gene Alias CPN10|GROES|HSP10
Gene Description heat shock 10kDa protein 1 (chaperonin 10)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPE1 (AAH23518, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3336
Clone Number 4C11-B11
Iso type IgG1 kappa

Enviar un mensaje


HSPE1 monoclonal antibody (M01), clone 4C11-B11

HSPE1 monoclonal antibody (M01), clone 4C11-B11