HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003315-D01P
HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPB1 protein.
Información adicional
Size 100 ug
Gene Name HSPB1
Gene Alias CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene Description heat shock 27kDa protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPB1 (NP_001531.1, 1 a.a. ~ 205 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3315

Enviar un mensaje


HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)

HSPB1 purified MaxPab rabbit polyclonal antibody (D01P)