HSPB1 polyclonal antibody (A01)
  • HSPB1 polyclonal antibody (A01)

HSPB1 polyclonal antibody (A01)

Ref: AB-H00003315-A01
HSPB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HSPB1.
Información adicional
Size 50 uL
Gene Name HSPB1
Gene Alias CMT2F|DKFZp586P1322|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27
Gene Description heat shock 27kDa protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPB1 (NP_001531, 96 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3315

Enviar un mensaje


HSPB1 polyclonal antibody (A01)

HSPB1 polyclonal antibody (A01)