HSPA6 monoclonal antibody (M01), clone 6H7
  • HSPA6 monoclonal antibody (M01), clone 6H7

HSPA6 monoclonal antibody (M01), clone 6H7

Ref: AB-H00003310-M01
HSPA6 monoclonal antibody (M01), clone 6H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HSPA6.
Información adicional
Size 100 ug
Gene Name HSPA6
Gene Alias -
Gene Description heat shock 70kDa protein 6 (HSP70B')
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPA6 (NP_002146.2, 544 a.a. ~ 643 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3310
Clone Number 6H7
Iso type IgG1 Kappa

Enviar un mensaje


HSPA6 monoclonal antibody (M01), clone 6H7

HSPA6 monoclonal antibody (M01), clone 6H7